PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_22402_iso_1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family MYB
Protein Properties Length: 299aa    MW: 33869.5 Da    PI: 6.1794
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_22402_iso_1genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding57.72.6e-181562148
                                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
                      Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                                         rgrWT+eEde+l++++kq G g+W++ ++  g+ R++k+c++rw +yl
  cra_locus_22402_iso_1_len_896_ver_3 15 RGRWTAEEDEILINYIKQNGEGSWRSLPKNAGLLRCGKSCRLRWINYL 62
                                         8*******************************99************97 PP

2Myb_DNA-binding55.21.6e-1768113148
                                          TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
                      Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                                          rg+++ eE+e ++++++  G++ W++Ia++++ gRt++++k++w+++l
  cra_locus_22402_iso_1_len_896_ver_3  68 RGNFSVEEEETIIKLHTSVGNR-WSLIASHLP-GRTDNEVKNYWNSHL 113
                                          89********************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.4E-23665IPR009057Homeodomain-like
PROSITE profilePS5129417.8661062IPR017930Myb domain
SuperFamilySSF466896.6E-2912109IPR009057Homeodomain-like
SMARTSM007173.7E-131464IPR001005SANT/Myb domain
PfamPF002491.1E-151562IPR001005SANT/Myb domain
CDDcd001672.86E-101762No hitNo description
PROSITE profilePS5129425.87363117IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.1E-2566117IPR009057Homeodomain-like
SMARTSM007171.6E-1667115IPR001005SANT/Myb domain
PfamPF002493.5E-1568113IPR001005SANT/Myb domain
CDDcd001675.44E-1170113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0051555Biological Processflavonol biosynthetic process
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 299 aa     Download sequence    Send to blast
KMGRAPCCEK VGLKRGRWTA EEDEILINYI KQNGEGSWRS LPKNAGLLRC GKSCRLRWIN  60
YLRADLKRGN FSVEEEETII KLHTSVGNRW SLIASHLPGR TDNEVKNYWN SHLSRKIYSF  120
KTNNGSLLNS RDVLQMTKST TSKRRGGRVS RAIAKKYNKP IPLEIQQSQE THDSCYEGQE  180
VLFHDSILMG SSSKELGGGG GEIEVMGTYE DDHQTSTDDV TTLVDQFFLS ELSDLYKISI  240
NNDEQKVNAT TTSMVPENSI NSEEWKSETW HSISNSSLDS GLLDECFSPL NSYFDDMVX
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-24131175108B-MYB
1h8a_C6e-241311725128MYB TRANSFORMING PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00627PBMTransfer from PK06182.1Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011071652.17e-85PREDICTED: transcription factor MYB12
SwissprotO222648e-74MYB12_ARATH; Transcription factor MYB12
TrEMBLA0A068TR643e-89A0A068TR64_COFCA; Uncharacterized protein
STRINGPOPTR_0010s15090.18e-76(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12242154